| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
ARTICLES |
The Clayton Foundation Laboratories for Peptide Biology, The Salk Institute, La Jolla, California 92037-1099
Address all correspondence and requests for reprints to: Marilyn Perrin, Ph.D., The Clayton Foundation Laboratories for Peptide Biology, The Salk Institute, 10010 North Torrey Pines Road, La Jolla, California 92037-1099. E-mail: perrin{at}salk.edu
| Abstract |
|---|
|
|
|---|
| Introduction |
|---|
|
|
|---|
(7) and CRF-R2ß (8, 9, 10). In the rat, CRF-R2
is found
mainly in the central nervous system (6), whereas CRF-R2ß is
expressed predominantly in peripheral tissues such as the heart,
muscle, epididymis, and the gastrointestinal tract (8, 9, 10). Both CRF
receptors are members of a 7-transmembrane domain receptor family that
includes receptors for calcitonin, vasoactive intestinal peptide,
secretin, and GH-releasing factor (GRF). Overall, CRF-R1 and CRF-R2 are approximately 68% homologous but approximately 80% homologous in the transmembrane domains and identical in the third intracellular loop that is assumed to be important for interactions with G proteins. The significant differences in the sequences between the two receptor types, as well as between the two splice variants of CRF-R2, occur in their extracellular domains.
An important question deals with the structural features that may be involved in ligand binding and subsequent signaling of these receptors. There are extensive data on the structural requirements for binding and signaling of other peptide as well as nonpeptide hormone receptors, including those that are characterized by 7-transmembrane domains and are coupled to G proteins. For the small nonpeptide hormones such as adrenaline and related agents as well as for the small peptide hormone, TRF, the binding domains are proposed to be in the transmembrane domains (11, 12). The receptors extracellular domains are important for binding ligands like acetylcholine and GABA (13) and the large glycoprotein hormones such as follicle stimulating hormone (14). More relevant to the CRF-R are the GRF, calcitonin, PTH, VIP, and secretin receptors that appear to contain major binding determinants in their extracelullar domains (15, 16, 17, 18).
Another question to be considered is whether agonists and antagonists
bind to different regions of the receptor. For the tachykinin
receptors, a difference has been found between the binding domains for
agonists and antagonists (19). Another example is that of the opioid
receptors, for which the fourth extracellular domain was found to
determine the selectivity of the
-opioid agonists (20).
Functional analyses of mutant receptors have provided insight into the structural requirements for receptor-ligand interactions. The goal of the work presented here was to use mutational analysis as a tool to investigate the roles of the various domains of the CRF-R in binding CRF ligands. We created chimeric receptors between the CRF-R and GRF or activin receptors to study the effect of the receptors extracellular domains on the binding CRF ligands.
| Materials and Methods |
|---|
|
|
|---|
For example, to create the E1c/GRF-R chimera, an upstream primer (I) complementary to nucleotides encoding amino acids nos. 17 of the rCRF-R and a downstream primer (II) whose 3'-end was complementary to nucleotides coding for amino acids 121125 of the rCRF-R and whose 5' end was complementary to nucleotides encoding amino acids 136141 of the rGRF-R were used to amplify the rCRF-R in a first round of PCR. The second round of PCR used the amplified product from the first round together with a downstream primer (III) complementary to nucleotides encoding amino acids 418-stop of the rGRF-R to amplify the rGRF-R. The final PCR product was ligated into pcDNA3 (Invitrogen) using BamHI and XhoI restriction sites which were included in primers (I) and (III), respectively.
Chimeras in which the other extracellular domains were exchanged were created by using PCR and E1c/GRF-R as the template. For example, for the E1c/E2c/GRF-R, the first round of PCR used the pair of primers: (I) and (IV) to amplify E1c/GRF-R and the pair of primers (III) and (V) to amplify the rGRF-R.
The sequences of the primers were:
(I): 5'-GATCGGATCCATGGGACGGCGCCCGCAGCTC
(II): 5'-CAATGGAGATGCTGTGGCCCAGGTAGTTGATGATG
(III): 5'-GATCCTCGAGCTAGCACTCAGAGGTGAGCAC
(IV): 5'-TTGCTCTGGTGCACCTCGGGGCTCACGGTGAGCTGGA-CCAGGAACACAGCACTGG
(V): 5'-GCCCCGAGGTGCACCAGAGCAATGTGGCCTGGTGTAG-GGTCTCTGTGGCCGTCTC
The two PCR products were then annealed and amplified using primers (I) and (III), and the product of this reaction was finally ligated into pcDNA3. Sequences were confirmed by dideoxy sequencing.
Membrane fractions
Crude membrane fractions were prepared from transiently
transfected COSM6 cells as previously described (1, 24) and stored in
10% sucrose at -80 C until use. Protein concentrations were
determined with the Biorad assay kit using
-globulin as
standard.
Peptide radioiodination
The peptides, [DTyr1]Astressin
(cyclo(3033)[yHLLREVLEXARAEQLAQEAHKNRKLXEII-amide) (where X =
Nle and y = DTyr) and [Tyr0]rUcn
(YDDPPLSIDLTFHLLRTLLELARTQSQRERAEQNRIIFDSV) were synthesized as
described in (25), radioiodinated using the chloramine-T (Sigma
Chemical Co., St. Louis, MO) method and purified by HPLC as previously
described (24, 25, 26).
Receptor binding assays
The RRAs were performed in a manner similar to that previously
described (24). Crude membrane fractions (10 µg-200 µg protein)
were combined with 50,000120,000 cpm Ast1 or Ucn1 and peptide
competitors in assay buffer (10 mM MgSO4,
0.075% BSA, 7.5% Sucrose, and 1.75 mM EGTA) for 2 h
at 20 C. Reactions were performed in 96-well MultiScreen plates
(Millipore, Bedford, MA) with GF/C filters, prewetted with 0.1%
polyethyleneimine, for Ast1 binding or with 0.22 µ Durapore filters,
prewetted with assay buffer for Ucn1 binding. The reaction was
terminated by aspiration through the plate, followed by 0.2 ml wash
with assay buffer. Inhibitory binding dissociation constants
(Ki) values and their 95% confidence limits were
determined from at least three independent homologous competitive
displacement assays. The data from the experiments were pooled and
analyzed with the LIGAND computer program (27).
| Results |
|---|
|
|
|---|
|
|
10
nM). As a further test of the ability of the N-terminal
domain to recognize CRF ligands, we determined whether urocortin and
astressin could bind to a chimera in which the N-terminal domain of the
activin IIB receptor was replaced by that of the CRF-R
(E1c/ActIIB-R). This chimera lacked all other domains
of the 7-transmembrane receptors. There was significant specific
binding of Ast1 and displacement by both CRF ligands: The
Ki values for astressin and urocortin on this chimera were
3.5 (1.87.0) nM and 8.2 (4.116) nM,
respectively (n = 3). It is interesting that there was relatively
high affinity binding of these CRF ligands to E1c/ActIIB-R
chimera in absence of any related transmembrane or intracellular
domains. One unexplained result was that even though urocortin was able
to competitively displace Ast1, there was no detectable specific
binding of labeled urocortin (i.e. Ucn1) to the
E1c/ActIIB-R chimera. The effects of the other extracellular domains on CRF binding were investigated by creating another series of chimeras. One chimera, E1g/CRF-R, was made by replacing the N-terminal domain of the CRF-R by that of the GRF-R; this chimera lacked the first extracellular domain of the CRF-R but retained extracellular domains 24 as well as its transmembrane and intracellular regions. Other chimeras were constructed so that the second to fourth extracellular domains in the E1c/GRF-R chimera were successively replaced by the corresponding domains of the CRF-R. Extracellular domains 24 were substituted separately (e.g. E1c/E2c/GRF-R), in pairs (e.g. E1c/E2c/E3c/GRF-R), or all three together (E1c/E2c/E3c/E4c/GRF-R).
There was no detectable specific binding of either Ast1 or Ucn1 to
E1g/CRF-R. There was specific, displaceable binding of Ast1
to all the other chimeras and binding of Ucn1 to most of them (Table 1
). In chimeras containing E3c, the specific binding/mg
protein was lower for Ucn1 than for Ast1; in two cases,
E1c/E3c/GRF-R and
E1c/E2c/E3c/GRF-R, the specific
binding of Ucn1 was so small that it was not possible to determine,
accurately, the Ki for urocortin using Ucn1.
Inclusion of the second extracellular domain,
(E1c/E2c/GRF-R), did not affect the
Ki values of astressin or urocortin compared with their
values for E1c/GRF-R itself. Expression of E3c
did not change appreciably the Ki for astressin. The
chimera that included both the first and fourth extracellular domains,
(E1c/E4c/GRF-R), exhibited lower Ki
values of both analogs (Ki = 4.2 nM for
astressin and Ki = 1.6 nM for urocortin)
compared with the Ki values for E1c/GRF-R
(
10 nM).
The expression of E1c together with pairs of other extracellular domains yielded the following results: the combination of extracellular domains 2 and 4 or 3 and 4 resulted in Ki values for both astressin and urocortin that were not significantly different from Ki values for E1c/GRF-R alone. The chimera containing the pair of domains 2 and 3, (E1c/E2c/E3c/GRF-R) bound astressin with a Ki = 5.4 nM, a value that was slightly lower than that for E2c or E3c separately. Although this chimera showed no usable specific binding of Ucn1, urocortin was able to displace Ast1.
A chimera expressing all four extracellular domains of the CRF-R, E1c/E2c/E3c/E4c/GRF-R, bound both Ast1 and Ucn1, and the Ki values for were 4.3 nM and 1.3 nM for astressin and urocortin, respectively. These values were practically the same as those for the chimera E1c/E4c/GRF-R.
| Discussion |
|---|
|
|
|---|
In this study, we divided the receptor into relatively large domains, namely the N-terminal portion and the extracellular loops. To investigate the contribution to the binding of CRF ligands of the first extracellular domain, E1c, (i.e. the N-terminus) we created two chimeras: in one, E1c took the place of the corresponding region of the GRF-R (E1c/GRF-R) so that the GRF-R contributed extracellular domains 24 with which E1c might interact. To eliminate these interactions we created another chimera in which no such interactions were possible, namely E1c/ActIIB-R, in which E1c of the CRF-R replaced the extracellular domain of the activin IIB receptor. The activin receptor is a serine/threonine kinase that has only one transmembrane and intracellular domain (23).
The data from E1c/GRF-R and E1c/ActIIB-R suggested that the first extracellular domain of the CRF-R contained major binding determinants for both the CRF agonist and antagonist. There was significant specific binding of astressin and urocortin to both E1c-expressing chimeras. Indeed, the observation that the Ki for astressin binding to E1c/ActIIB-R was no higher than that for binding to E1c/GRF-R suggested that the extracellular loops of the GRF-R that were present in the latter did not contribute significantly to the ligand recognition. Using a similar approach, Osuga et al. (18) fused the E1 of the LH or FSH receptors to the single transmembrane domain of the CD8 receptor and obtained high affinity ligand binding (18).
The roles of the other extracellular domains of the receptor were explored by creating mutants in which E2c-E4c were successively substituted for the corresponding domains of the GRF-R that were present in the E1c/GRF-R chimera. Inclusion of extracellular domains 2 or 3, or both together, produced chimeras that bound astressin and urocortin with Ki values approximately 510 nM, i.e. not much different from the corresponding Ki values obtained for the E1c/GRF-R chimera in which there were no other CRF extracellular regions. Inclusion of E4c resulted in Ki values for both astressin and urocortin that were lower than those for E1c/GRF-R, although the difference was not statistically significant in the case of urocortin.
Our data may be compared with those obtained from the secretin/VIP chimeric receptors (17, 28). For high affinity secretin binding, the first extracellular domain alone was not sufficient but required both the first and second extracellular domains, whereas the first extracellular domain of the VIP receptor sufficed to produce characteristic VIP responses. Studies with calcitonin/glucagon chimeras suggested that the N-terminal domain was important for binding calcitonin (29). The data for the PTH receptor were similar to those for CRF-R in that the first and fourth extracellular domains were found to be critical for ligand binding (16).
In conclusion, we have shown that for CRF-R1 the extracellular domains, specifically the N-terminus, contained important binding determinants for both CRF antagonists and agonists.
| Acknowledgments |
|---|
| Footnotes |
|---|
2 FMR, Inc., and FFR senior principal investigator. ![]()
Received October 1, 1997.
| References |
|---|
|
|
|---|
- opioid receptor determines the
selectivity of the
- opioid agonists. Mol Pharm 50:16191624[Abstract]
This article has been cited by other articles:
![]() |
K. Gkountelias, T. Tselios, M. Venihaki, G. Deraos, I. Lazaridis, O. Rassouli, A. Gravanis, and G. Liapakis Alanine Scanning Mutagenesis of the Second Extracellular Loop of Type 1 Corticotropin-Releasing Factor Receptor Revealed Residues Critical for Peptide Binding Mol. Pharmacol., April 1, 2009; 75(4): 793 - 800. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. Assil-Kishawi, T. A. Samra, D. F. Mierke, and A. B. Abou-Samra Residue 17 of Sauvagine Cross-links to the First Transmembrane Domain of Corticotropin-releasing Factor Receptor 1 (CRFR1) J. Biol. Chem., December 19, 2008; 283(51): 35644 - 35651. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. A. Pioszak, N. R. Parker, K. Suino-Powell, and H. E. Xu Molecular Recognition of Corticotropin-releasing Factor by Its G-protein-coupled Receptor CRFR1 J. Biol. Chem., November 21, 2008; 283(47): 32900 - 32912. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. R. J. Hoare, B. A. Fleck, R. S. Gross, P. D. Crowe, J. P. Williams, and D. E. Grigoriadis Allosteric Ligands for the Corticotropin Releasing Factor Type 1 Receptor Modulate Conformational States Involved in Receptor Activation Mol. Pharmacol., May 1, 2008; 73(5): 1371 - 1380. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. H. Perrin, C. R. R. Grace, M. R. DiGruccio, W. H. Fischer, S. K. Maji, J. P. Cantle, S. Smith, G. Manning, W. W. Vale, and R. Riek Distinct Structural and Functional Roles of Conserved Residues in the First Extracellular Domain of Receptors for Corticotropin-releasing Factor and Related G-protein-coupled Receptors J. Biol. Chem., December 28, 2007; 282(52): 37529 - 37536. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. R. R. Grace, M. H. Perrin, J. Gulyas, M. R. DiGruccio, J. P. Cantle, J. E. Rivier, W. W. Vale, and R. Riek Structure of the N-terminal domain of a type B1 G protein-coupled receptor in complex with a peptide ligand PNAS, March 20, 2007; 104(12): 4858 - 4863. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. F. Mesleh, W. A. Shirley, C. E. Heise, N. Ling, R. A. Maki, and R. P. Laura NMR Structural Characterization of a Minimal Peptide Antagonist Bound to the Extracellular Domain of the Corticotropin-releasing Factor1 Receptor J. Biol. Chem., March 2, 2007; 282(9): 6338 - 6346. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. Cao, N. Papadopoulou, D. Kempuraj, W. S. Boucher, K. Sugimoto, C. L. Cetrulo, and T. C. Theoharides Human Mast Cells Express Corticotropin-Releasing Hormone (CRH) Receptors and CRH Leads to Selective Secretion of Vascular Endothelial Growth Factor J. Immunol., June 15, 2005; 174(12): 7665 - 7675. [Abstract] [Full Text] [PDF] |
||||
![]() |
C. R. R. Grace, M. H. Perrin, M. R. DiGruccio, C. L. Miller, J. E. Rivier, W. W. Vale, and R. Riek NMR structure and peptide hormone binding site of the first extracellular domain of a type B1 G protein-coupled receptor PNAS, August 31, 2004; 101(35): 12836 - 12841. [Abstract] [Full Text] [PDF] |
||||
![]() |
V. Pham, J. D. Wade, B. W. Purdue, and P. M. Sexton Spatial Proximity between a Photolabile Residue in Position 19 of Salmon Calcitonin and the Amino Terminus of the Human Calcitonin Receptor J. Biol. Chem., February 20, 2004; 279(8): 6720 - 6729. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. H. Perrin, M. R. DiGruccio, S. C. Koerber, J. E. Rivier, K. S. Kunitake, D. L. Bain, W. H. Fischer, and W. W. Vale A Soluble Form of the First Extracellular Domain of Mouse Type 2beta Corticotropin-releasing Factor Receptor Reveals Differential Ligand Specificity J. Biol. Chem., April 25, 2003; 278(18): 15595 - 15600. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. Lopez de Maturana, A. Willshaw, A. Kuntzsch, R. Rudolph, and D. Donnelly The Isolated N-terminal Domain of the Glucagon-like Peptide-1 (GLP-1) Receptor Binds Exendin Peptides with Much Higher Affinity than GLP-1 J. Biol. Chem., March 14, 2003; 278(12): 10195 - 10200. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. R. J. Hoare, S. K. Sullivan, N. Ling, P. D. Crowe, and D. E. Grigoriadis Mechanism of Corticotropin-Releasing Factor Type I Receptor Regulation by Nonpeptide Antagonists Mol. Pharmacol., March 1, 2003; 63(3): 751 - 765. [Abstract] [Full Text] [PDF] |
||||
![]() |
F. M. Dautzenberg, J. Higelin, O. Brauns, B. Butscha, and R. L. Hauger Five Amino Acids of the Xenopus laevis CRF (Corticotropin-Releasing Factor) Type 2 Receptor Mediate Differential Binding of CRF Ligands in Comparison with Its Human Counterpart Mol. Pharmacol., May 1, 2002; 61(5): 1132 - 1139. [Abstract] [Full Text] [PDF] |
||||
![]() |
I. Q. Assil and A. B. Abou-Samra N-glycosylation of CRF receptor type 1 is important for its ligand-specific interaction Am J Physiol Endocrinol Metab, November 1, 2001; 281(5): E1015 - E1021. [Abstract] [Full Text] [PDF] |
||||
![]() |
F. M. Dautzenberg, G. Py-Lang, J. Higelin, C. Fischer, M. B. Wright, and G. Huber Different Binding Modes of Amphibian and Human Corticotropin-Releasing Factor Type 1 and Type 2 Receptors: Evidence for Evolutionary Differences J. Pharmacol. Exp. Ther., January 1, 2001; 296(1): 113 - 120. [Abstract] [Full Text] |
||||
![]() |
D. K. Grammatopoulos, H. S. Randeva, M. A. Levine, E. S. Katsanou, and E. W. Hillhouse Urocortin, but Not Corticotropin-Releasing Hormone (CRH), Activates the Mitogen-Activated Protein Kinase Signal Transduction Pathway in Human Pregnant Myometrium: An Effect Mediated via R1{{alpha}} and R2{beta} CRH Receptor Subtypes and Stimulation of Gq-Proteins Mol. Endocrinol., December 1, 2000; 14(12): 2076 - 2091. [Abstract] [Full Text] |
||||
![]() |
S. M. Nielsen, L. Z. Nielsen, S. A. Hjorth, M. H. Perrin, and W. W. Vale Constitutive activation of tethered-peptide/ corticotropin-releasing factor receptor chimeras PNAS, August 29, 2000; 97(18): 10277 - 10281. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Beyermann, S. Rothemund, N. Heinrich, K. Fechner, J. Furkert, M. Dathe, R. Winter, E. Krause, and M. Bienert A Role for a Helical Connector between Two Receptor Binding Sites of a Long-chain Peptide Hormone J. Biol. Chem., February 25, 2000; 275(8): 5702 - 5709. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. K. Grammatopoulos, Y. Dai, H. S. Randeva, M. A. Levine, E. Karteris, A. J. Easton, and E. W. Hillhouse A Novel Spliced Variant of the Type 1 Corticotropin-Releasing Hormone Receptor with a Deletion in the Seventh Transmembrane Domain Present in the Human Pregnant Term Myometrium and Fetal Membranes Mol. Endocrinol., December 1, 1999; 13(12): 2189 - 2202. [Abstract] [Full Text] |
||||
![]() |
F. Petraglia, P. Florio, C. Benedetto, L. Marozio, A. M. Di Blasio, C. Ticconi, E. Piccione, S. Luisi, A. R. Genazzani, and W. Vale Urocortin Stimulates Placental Adrenocorticotropin and Prostaglandin Release and Myometrial Contractility in Vitro J. Clin. Endocrinol. Metab., April 1, 1999; 84(4): 1420 - 1423. [Abstract] [Full Text] |
||||
![]() |
F. M. Dautzenberg, S. Wille, R. Lohmann, and J. Spiess Mapping of the ligand-selective domain of the Xenopus laevis corticotropin-releasing factor receptor 1: Implications for the ligand-binding site PNAS, April 28, 1998; 95(9): 4941 - 4946. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. H. Perrin, W. H. Fischer, K. S. Kunitake, A. G. Craig, S. C. Koerber, L. A. Cervini, J. E. Rivier, J. C. Groppe, J. Greenwald, S. M. Nielsen, et al. Expression, Purification, and Characterization of a Soluble Form of the First Extracellular Domain of the Human Type 1 Corticotropin Releasing Factor Receptor J. Biol. Chem., August 17, 2001; 276(34): 31528 - 31534. [Abstract] [Full Text] [PDF] |
||||
![]() |
E. C. Tibaduiza, C. Chen, and M. Beinborn A Small Molecule Ligand of the Glucagon-like Peptide 1 Receptor Targets Its Amino-terminal Hormone Binding Domain J. Biol. Chem., October 5, 2001; 276(41): 37787 - 37793. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOME | HELP | FEEDBACK | SUBSCRIPTIONS | ARCHIVE | SEARCH | TABLE OF CONTENTS |
| Endocrinology | Endocrine Reviews | J. Clin. End. & Metab. |
| Molecular Endocrinology | Recent Prog. Horm. Res. | All Endocrine Journals |